CCDC71 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC71 Polyclonal antibody, PBS Only (28152-1-PBS)

• 

  WB analysis using 28152-1-AP (same clone as 28152-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28152-1-AP (CCDC71 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28152-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28152-1-AP (same clone as 28152-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28152-1-AP (CCDC71 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28152-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28152-1-AP (same clone as 28152-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28152-1-AP (CCDC71 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28152-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28152-1-AP (same clone as 28152-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28152-1-AP (CCDC71 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28152-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28152-1-AP (same clone as 28152-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28152-1-AP (CCDC71 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28152-1-PBS in a different storage buffer formulation.

CCDC71 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28152-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28152-1-PBS targets CCDC71 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27446

  Product name: Recombinant human CCDC71 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 207-449 aa of BC035516

  Sequence: DSPLKLRKSSGKGPGNPRPKAPRKTTSKGPKCLTRKGPGAGPRRGSGHQSKTNRATGSPSVRRMKGGSALGTKTAQAKVARTLAKAARAQAKVARTQAKAAKARAKAKAAQVKAKAKAKAAQVKAKAKVMAAWAKAKAKAKAVRAKAKVARTQPRGRGRPKGSAKARTTRKGQKNRPETVGQKRKRAEEAKDLPPKKRTRLGPRSPKAWLGPGTAKLLKFRAIKVDRRSSDDEVRQRAQRILR

• Full Name: coiled-coil domain containing 71
• Calculated Molecular Weight: 467 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC035516
• Gene Symbol: CCDC71
• Gene ID (NCBI): 64925
• RRID: AB_2881075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IV32
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.