CCDC85C Polyclonal antibody

• 

  WB analysis using 31200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31200-1-AP (CCDC85C antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

CCDC85C Polyclonal Antibody for WB, ELISA

Cat No. 31200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

FLJ22558

---

Tested Applications

• Positive WB detected in: HCT 116 cells, MCF-7 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31200-1-AP targets CCDC85C in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35157

  Product name: Recombinant human CCDC85C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-390 aa of NM_001144995

  Sequence: HHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCN

• Full Name: coiled-coil domain containing 85C
• Calculated Molecular Weight: 419 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: NM_001144995
• Gene Symbol: CCDC85C
• Gene ID (NCBI): 317762
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NKD9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ccdc85c (coiled-coil domain containing 85c) is a gene encoding protein, which is located on human chromosome 14 (14q32.2) and belongs to the helical loop domain protein family. The protein is mainly expressed in the neuroepithelial cells of the lateral ventricle wall of the brain, especially at the top junction of radial glial cells. In addition, it is also expressed in a variety of monolayer epithelial cells, but not in stratified epithelial cells. CCDC85C is the pathogenic gene of hereditary hydrocephalus and subcortical endometriosis (often accompanied by cerebral hemorrhage). In CCDC85C gene knockout (KO) mice and rats, abnormal development of ventricular system was observed, resulting in hydrocephalus and cerebral hemorrhage (PMID: 37271245).