Cyclon/CCDC86 Polyclonal antibody

Cyclon/CCDC86 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 14947-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

CYCLON, CCDC86, Cytokine-induced protein with coiled-coil domain, Coiled-coil domain-containing protein 86

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse stomach tissue, HepG2 cells, human heart tissue, human liver tissue, human stomach tissue
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14947-1-AP targets Cyclon/CCDC86 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6754

Product name: Recombinant human CCDC86 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-360 aa of BC001378

Sequence: MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI

Predict reactive species
Full Name coiled-coil domain containing 86
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC001378
Gene Symbol CCDC86
Gene ID (NCBI) 79080
RRIDAB_2072318
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6F5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC86 (Coiled-coil domain-containing protein 86), also known as Cyclon (cytokine-induced protein with coiled-coil domain) ) is known for its expression in leukocytes in mice, where it regulates the immune response. Cyclon/CCDC86 regulates the apoptosis of T-cells upon activation, a process known as an activationinduced cellular death (AICD), by regulating the expression of the death receptor Fas on T-cells (PMID: 23439384). CCDC86 depletion led to a novel phenotype in which Ki-67 and nucleolin could still accumulate at the chromosome periphery but also formed abnormal cytoplasmic NDF-like foci (PMID: 36695333). The detected molecular weights (MWs) of Cyclon on SDS-PAGE (human Cyclon: 65 kDa; mouse Cyclon: 75 kDa) were higher than calculated MWs (human Cyclon: 40.2 kDa; mouse Cyclon: 46.5 kDa), suggesting possible modifications of Cyclon (PMID: 17300783).

Protocols

Product Specific Protocols
IF protocol for Cyclon/CCDC86 antibody 14947-1-APDownload protocol
WB protocol for Cyclon/CCDC86 antibody 14947-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...