CCDC97 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC97 Polyclonal antibody, PBS Only (31996-1-PBS)

• 

  WB analysis using 31996-1-AP (same clone as 31996-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31996-1-AP (CCDC97 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31996-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 31996-1-AP (same clone as 31996-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 31996-1-AP (CCDC97 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31996-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 31996-1-AP (same clone as 31996-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 31996-1-AP (CCDC97 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31996-1-PBS in a different storage buffer formulation.

CCDC97 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31996-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Coiled-coil domain-containing protein 97

---

Product Information

31996-1-PBS targets CCDC97 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36049

  Product name: Recombinant human CCDC97 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-343 aa of BC011577

  Sequence: LQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD

• Full Name: coiled-coil domain containing 97
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC011577
• Gene Symbol: CCDC97
• Gene ID (NCBI): 90324
• RRID: AB_3670170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96F63
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC97 is one of CCDC family proteins. Alterations in expression, mutation, and DNA promoter methylation of CCDC family genes have been shown to be associated with the pathogenesis of many diseases, including primary ciliary dyskinesia, infertility, and tumors (PMID: 37182638). It has been reported that CCDC97 may be involved in Coronary artery disease (PMID: 27386823).