Product Information
31996-1-PBS targets CCDC97 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36049 Product name: Recombinant human CCDC97 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-343 aa of BC011577 Sequence: LQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD Predict reactive species |
| Full Name | coiled-coil domain containing 97 |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC011577 |
| Gene Symbol | CCDC97 |
| Gene ID (NCBI) | 90324 |
| RRID | AB_3670170 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96F63 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CCDC97 is one of CCDC family proteins. Alterations in expression, mutation, and DNA promoter methylation of CCDC family genes have been shown to be associated with the pathogenesis of many diseases, including primary ciliary dyskinesia, infertility, and tumors (PMID: 37182638). It has been reported that CCDC97 may be involved in Coronary artery disease (PMID: 27386823).





