Home
Products
Primary Antibodies
CCL17/TARC Polyclonal antibody, PBS Only (22342-1-PBS)

Filter: AllIHC

IHC staining of human colon using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 22342-1-AP (same clone as 22342-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22342-1-AP (CCL17 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22342-1-PBS in a different storage buffer formulation.

CCL17/TARC Polyclonal antibody, PBS Only

Name: CCL17/TARC Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 22342-1-PBS

CCL17/TARC Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 22342-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

CCL17, TARC, CCL-17, CCL 17, C-C motif chemokine 17

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

22342-1-PBS targets CCL17/TARC in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag17832 Product name: Recombinant human CCL17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-94 aa of BC112066 Sequence: AARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS Predict reactive species
Full Name	chemokine (C-C motif) ligand 17
Calculated Molecular Weight	94 aa, 11 kDa
GenBank Accession Number	BC112066
Gene Symbol	CCL17
Gene ID (NCBI)	6361
RRID	AB_2879081
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92583
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.