Product Information
13814-1-PBS targets CCL21 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4897 Product name: Recombinant human CCL21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-134 aa of BC027918 Sequence: RTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 21 |
| Calculated Molecular Weight | 134 aa, 15 kDa |
| GenBank Accession Number | BC027918 |
| Gene Symbol | CCL21 |
| Gene ID (NCBI) | 6366 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00585 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
