Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human CCL24/Eotaxin 2 Rabbit Recombinant Antibody, PBS Only (98476-3-PBS)

Anti-Human CCL24/Eotaxin 2 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human CCL24/Eotaxin 2 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98476-3-PBS-1MG

CCL24/Eotaxin 2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98476-3-PBS

Clone No. 243063C9

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CCL24, Eotaxin 2, C C motif chemokine 24, C-C motif chemokine 24, CCL 24

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of CHO using 98476-3-RR (same clone as 98476-3-PBS)
1x10^6 CHO-K1 cells (left) or CCL24/Eotaxin 2-transfected CHO-K1 cells (right) were intracellularly stained with 0.25 ug Anti-Human CCL24/Eotaxin 2 Rabbit RecAb (98476-3-RR, Clone: 243063C9) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98476-3-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 CHO-K1 cells (left) or CCL24/Eotaxin 2-transfected CHO-K1 cells (right) were intracellularly stained with 0.25 ug Anti-Human CCL24/Eotaxin 2 Rabbit RecAb (98476-3-RR, Clone: 243063C9) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98476-3-PBS in a different storage buffer formulation.
FC experiment of CHO using 98476-3-RR (same clone as 98476-3-PBS)
1x10^6 CHO cells (left) or CCL24/Eotaxin 2-transfected CHO cells (right) were intracellularly stained with 0.25 ug Anti-Human CCL24/Eotaxin 2 Rabbit RecAb (98476-3-RR, Clone: 243063C9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98476-3-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 CHO cells (left) or CCL24/Eotaxin 2-transfected CHO cells (right) were intracellularly stained with 0.25 ug Anti-Human CCL24/Eotaxin 2 Rabbit RecAb (98476-3-RR, Clone: 243063C9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98476-3-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for CCL24/Eotaxin 2 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98476-3-PBS targets CCL24/Eotaxin 2 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg0395 Product name: Recombinant Human CCL24 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6HIS Tag: C-6HIS Domain: 27-119 aa of NM_002991 Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Predict reactive species
Full Name	chemokine (C-C motif) ligand 24
Calculated Molecular Weight	13kd
GenBank Accession Number	NM_002991
Gene Symbol	CCL24/Eotaxin 2
Gene ID (NCBI)	6369
RRID	AB_3746106
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O00175
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Chemokine CCL24 is the second member of eotaxins, a group of eosinophils' selectively chemoattractants. CCL24 is constitutively expressed in fibroblasts, epithelial cells, macrophages. CCL24 has only one receptor CCR3, which mainly presents on eosinophils and was also found on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscles. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes.