CCL25/TECK Polyclonal antibody

• 

  IHC staining of human thymus using 25285-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 25285-1-AP (CCL25/TECK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thymus using 25285-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 25285-1-AP (CCL25/TECK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCL25/TECK Polyclonal Antibody for IHC, ELISA

Cat No. 25285-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF, ELISA

Synonyms

CCL25, TECK, C C motif chemokine 25, C-C motif chemokine 25, CCL 25

---

Tested Applications

• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

25285-1-AP targets CCL25/TECK in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17994

  Product name: Recombinant human CCL25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-150 aa of BC130561

  Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

• Full Name: chemokine (C-C motif) ligand 25
• Calculated Molecular Weight: 150 aa, 17 kDa
• GenBank Accession Number: BC130561
• Gene Symbol: CCL25/TECK
• Gene ID (NCBI): 6370
• RRID: AB_2880008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15444
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL25, also known as Thymus-Expressed Chemokine (TECK), is a small chemokine belonging to the CC subfamily, first isolated from mouse thymus in 1997. Its official full name is "C-C motif chemokine ligand 25". CCL25 is mainly expressed in the thymus and small-intestinal epithelium, and to a lesser extent by vascular endothelial cells and other parenchymal tissues. It selectively attracts dendritic cells, thymocytes, and activated macrophages via binding to its high-affinity G-protein-coupled receptor CCR9, while showing no chemotactic activity on peripheral blood lymphocytes or neutrophils. Through this CCR9-CCL25 axis it orchestrates T-cell development in the thymus and guides CCR9⁺ lymphocytes-especially IgA-producing plasma cells and intra-epithelial lymphocytes-to the small intestine, thus participating in mucosal immunity and gut homeostasis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; The immune landscape of human thymic epithelial tumors; Authors - Zhongwei Xin