CCL4/MIP-1 beta Polyclonal antibody

CCL4/MIP-1 beta Polyclonal Antibody for WB, ELISA
Cat No. 26614-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

ACT 2, ACT2, AT744.1, C C motif chemokine 4, CCL4, chemokine (C C motif) ligand 4, G 26, HC21, LAG 1, LAG1, MIP 1 beta, MIP 1 beta(1 69), MIP-1 beta, MIP1B, MIP1B1, MIP-1β, PAT 744, Protein H400, SCYA2, SCYA4, SIS gamma, Small inducible cytokine A4, T cell activation protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPMA, LPS and Brefeldin A treated THP-1 cells, Transfected HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26614-1-AP targets CCL4/MIP-1 beta in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25070

Product name: Recombinant human CCL4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-92 aa of BC107433

Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Predict reactive species
Full Name chemokine (C-C motif) ligand 4
Calculated Molecular Weight 92 aa, 10 kDa
Observed Molecular Weight10 kDa
GenBank Accession NumberBC107433
Gene Symbol CCL4/MIP-1 beta
Gene ID (NCBI) 6351
RRIDAB_3669554
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13236
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Protocols

Product Specific Protocols
WB protocol for CCL4/MIP-1 beta antibody 26614-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...