CCL5/RANTES Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CCL5/RANTES Recombinant monoclonal antibody (88173-1-RR)

CCL5/RANTES Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88173-1-RR

Clone No.260534G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CCL5, C C motif chemokine 5, C-C motif chemokine 5, CCL 5, CCL-5

• 

  WB analysis of human peripheral blood platelets using 88173-1-RR

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 88173-1-RR (CCL5/RANTES antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88173-1-RR

  PMA, LPS and Brefeldin A-treated THP-1 cells were subjected to SDS PAGE followed by western blot with 88173-1-RR (CCL5/RANTES antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88173-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88173-1-RR (CCL5/RANTES antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets, NK-92 cells, PMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88173-1-RR targets CCL5/RANTES in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2617

  Product name: Recombinant human CCL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC008600

  Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

• Full Name: chemokine (C-C motif) ligand 5
• Calculated Molecular Weight: 91 aa, 10 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC008600
• Gene Symbol: CCL5/RANTES
• Gene ID (NCBI): 6352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13501
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation.