cyclin C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• cyclin C Polyclonal antibody (26464-1-AP)

cyclin C Polyclonal Antibody for WB, ELISA

Cat No. 26464-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CCNC, CycC, cyclin C, hSRB11, SRB11 homolog

• 

  WB analysis of mouse skeletal muscle using 26464-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 26464-1-AP (CCNC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26464-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26464-1-AP (cyclin C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 26464-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 26464-1-AP (CCNC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for cyclin C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26464-1-AP targets cyclin C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23955

  Product name: Recombinant human CCNC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC056153

  Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

• Full Name: cyclin C
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC056153
• Gene Symbol: Cyclin C
• Gene ID (NCBI): 892
• RRID: AB_2880523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24863
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The cyclin C Polyclonal antibody (Cat# 26464-1-AP) has 5 citations across journals including Frontiers in Endocrinology, Oncotarget, Development, Biomedical Research International, and bioRxiv. Research fields span polycystic ovary syndrome and apoptosis regulation, colorectal cancer proliferation, neural progenitor cell development, hepatocellular carcinoma bioinformatics, and alveolar rhabdomyosarcoma differentiation. Applications cited include WB and IHC in human and mouse samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Endocrinol (Lausanne); Whole Genome Transcriptomic Analysis of Ovary Granulosa Cells Revealed an Anti-Apoptosis Regulatory Gene DLGAP5 in Polycystic Ovary Syndrome.; Authors - Yan Deng
human	WB	Oncotarget; RPN2 promotes colorectal cancer cell proliferation through modulating the glycosylation status of EGFR.; Authors - Haiping Li
mouse	WB	Development; Lin28-mediated promotion of protein synthesis is critical for neural progenitor cell maintenance and brain development in mice.; Authors - Stephanie Herrlinger
human	WB	Biomed Res Int; Integrated Bioinformatics Analysis of the Clinical Value and Biological Function of ATAD2 in Hepatocellular Carcinoma.; Authors - Xiangyu Meng
	WB,IHC	bioRxiv; CDK8 Inhibition Releases the Muscle Differentiation Block in Fusion-driven Alveolar Rhabdomyosarcoma; Authors - Susu Zhang