cyclin C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• cyclin C Polyclonal antibody (26464-1-AP)

cyclin C Polyclonal Antibody for WB, ELISA

Cat No. 26464-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CCNC, CycC, cyclin C, hSRB11, SRB11 homolog

• 

  WB analysis of mouse skeletal muscle using 26464-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 26464-1-AP (CCNC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26464-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26464-1-AP (cyclin C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 26464-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 26464-1-AP (CCNC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26464-1-AP targets cyclin C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23955

  Product name: Recombinant human CCNC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC056153

  Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

• Full Name: cyclin C
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC056153
• Gene Symbol: Cyclin C
• Gene ID (NCBI): 892
• RRID: AB_2880523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24863
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncotarget; RPN2 promotes colorectal cancer cell proliferation through modulating the glycosylation status of EGFR.; Authors - Haiping Li
human	WB	Front Endocrinol (Lausanne); Whole Genome Transcriptomic Analysis of Ovary Granulosa Cells Revealed an Anti-Apoptosis Regulatory Gene DLGAP5 in Polycystic Ovary Syndrome.; Authors - Yan Deng
human	WB	Biomed Res Int; Integrated Bioinformatics Analysis of the Clinical Value and Biological Function of ATAD2 in Hepatocellular Carcinoma.; Authors - Xiangyu Meng
mouse	WB	Development; Lin28-mediated promotion of protein synthesis is critical for neural progenitor cell maintenance and brain development in mice.; Authors - Stephanie Herrlinger
	WB,IHC	bioRxiv; CDK8 Inhibition Releases the Muscle Differentiation Block in Fusion-driven Alveolar Rhabdomyosarcoma; Authors - Susu Zhang