Cyclin D2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cyclin D2 Polyclonal antibody (10934-1-AP)

• Featured Product
• KD/KO Validated

Cyclin D2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10934-1-AP Copied!

Publications (73)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IP, ELISA

Synonyms

CCND2, G1/S-specific cyclin-D2, G1/S specific cyclin D2, Cyclin D

• 

  WB analysis using 10934-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10934-1-AP (Cyclin D2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10934-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10934-1-AP (Cyclin D2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10934-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10934-1-AP (Cyclin D2 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10934-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10934-1-AP (Cyclin D2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10934-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 10934-1-AP (Cyclin D2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 10934-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10934-1-AP (Cyclin D2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 10934-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10934-1-AP (Cyclin D2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 10934-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10934-1-AP (Cyclin D2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 10934-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10934-1-AP (Cyclin D2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 10934-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Cyclin D2 antibody (10934-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1) (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cyclin D2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, MCF-7 cells, NIH/3T3 cells, U2OS cells, HEK-293 cells
• Positive IHC detected in: human renal cell carcinoma tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10934-1-AP targets Cyclin D2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, bovine, sheep, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1377

  Product name: Recombinant human CCND2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC010958

  Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

• Full Name: cyclin D2
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC010958
• Gene Symbol: Cyclin D2
• Gene ID (NCBI): 894
• RRID: AB_2275319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30279
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCND2 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. CCND2 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND2 has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. High level expression of CCND2 was observed in ovarian and testicular tumors.

Publications

What published studies show

Rabbit Monoclonal Antibody to CCND2 (Cyclin D2), catalog number 10934-1-AP, has 73 citations published in journals including Nature, Cancer Cell, Molecular Cancer, Nature Communications, Science Advances, Developmental Cell, Oncogene, Leukemia, FASEB Journal, and Journal of Biological Chemistry. Research fields span oncology (breast, lung, gastric, ovarian, liver, leukemia, melanoma), cell cycle regulation, developmental biology, reproductive biology, neuroscience, renal disease, and veterinary science.

Automatically generated from the 73 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; The Oncogenic Transcription Factor RUNX1/ETO Corrupts Cell Cycle Regulation to Drive Leukemic Transformation.; Authors - Natalia Martinez-Soria ; KD Validated
mouse		Nature; SOX2 controls tumour initiation and cancer stem-cell functions in squamous-cell carcinoma.; Authors - Soufiane Boumahdi
human	WB	Mol Cancer; LncRNA TROJAN promotes proliferation and resistance to CDK4/6 inhibitor via CDK2 transcriptional activation in ER+ breast cancer.; Authors - Xi Jin
mouse		Kidney Int; Transcription factor MafB may play an important role in secondary hyperparathyroidism.; Authors - Naoki Morito
human	WB	Nat Commun; TP63 mediates the generation of tumour-specific chromatin loops that underlie MYC activation in radiation-induced tumorigenesis.; Authors - Qiaowei Liu
		Nucleic Acids Res; Lactylation of CREB is required for FSH-induced proliferation and differentiation of ovarian granulosa cells; Authors - Gang Wu