Product Information
10279-1-AP targets CCNI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0300 Product name: Recombinant human CCNI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 7-106 aa of BC000420 Sequence: LENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDE Predict reactive species |
| Full Name | cyclin I |
| Calculated Molecular Weight | 43 kDa |
| GenBank Accession Number | BC000420 |
| Gene Symbol | CCNI |
| Gene ID (NCBI) | 10983 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14094 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The CCNI polyclonal antibody (Cat# 10279-1-AP) has 1 citation. It appears in Journal of Medicinal Chemistry (IF 7.3), published in 2024. The cited study focuses on the discovery of dual PROTAC degraders targeting neurodegenerative disease-associated aggregates, using WB in human and mouse samples. The research field is neurodegenerative disease and targeted protein degradation.
| Species | Application | Title |
|---|---|---|
J Med Chem Discovery of Effective Dual PROTAC Degraders for Neurodegenerative Disease-Associated Aggregates |
