CCNI Polyclonal antibody

• 

CCNI Polyclonal Antibody for ELISA

Cat No. 10279-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cyclin-I, cyclin I

---

Published Applications

• WB: See 1 publications below

Product Information

10279-1-AP targets CCNI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0300

  Product name: Recombinant human CCNI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-106 aa of BC000420

  Sequence: LENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDE

• Full Name: cyclin I
• Calculated Molecular Weight: 43 kDa
• GenBank Accession Number: BC000420
• Gene Symbol: CCNI
• Gene ID (NCBI): 10983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14094
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	J Med Chem; Discovery of Effective Dual PROTAC Degraders for Neurodegenerative Disease-Associated Aggregates; Authors - Wentao Zhu