CCR1 Polyclonal antibody

• 

CCR1 Polyclonal Antibody for ELISA

Cat No. 25011-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

C C chemokine receptor type 1, C C CKR 1, CC CKR 1, CCR 1, CCR1, CD191, CKR 1, CKR1, CMKBR1, CMKR1, HM145, LD78 receptor, MIP 1alpha R, MIP1aR, RANTES R, SCYAR1

---

Product Information

25011-1-AP targets CCR1 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14538

  Product name: Recombinant human CCR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 264-355 aa of BC051306

  Sequence: FQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

• Full Name: chemokine (C-C motif) receptor 1
• Calculated Molecular Weight: 355 aa, 41 kDa
• GenBank Accession Number: BC051306
• Gene Symbol: CCR1
• Gene ID (NCBI): 1230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.