CCR5 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 82942-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 82942-3-PBS against Human CCR5 was performed. The affinity constant is 0.461 nM.

CCR5 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 82942-3-PBS

Clone No.230266D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

C C chemokine receptor type 5, C C CKR 5, C-C chemokine receptor type 5, CC CKR 5, C-C CKR-5

---

Product Information

82942-3-PBS targets CCR5 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11493

  Product name: Recombinant human CCR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 257-352 aa of BC038398

  Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

• Full Name: chemokine (C-C motif) receptor 5
• Calculated Molecular Weight: 352 aa, 41 kDa
• GenBank Accession Number: BC038398
• Gene Symbol: CCR5
• Gene ID (NCBI): 1234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51681
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.