Tested Applications
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
Product Information
66801-1-Ig targets CCR6 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24195 Product name: Recombinant human CCR6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-47 aa of BC037960 Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 6 |
| Calculated Molecular Weight | 42 kDa |
| GenBank Accession Number | BC037960 |
| Gene Symbol | CCR6 |
| Gene ID (NCBI) | 1235 |
| RRID | AB_2882144 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51684 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCR6, also known as CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed in most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector/memory T-cells, and B-cells and plays a role in skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CCR6 antibody 66801-1-Ig | Download protocol |
| IHC protocol for CCR6 antibody 66801-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis RANKL/RANK signaling recruits Tregs via the CCL20-CCR6 pathway and promotes stemness and metastasis in colorectal cancer | ||
Neoplasia Gut microbiota-derived short-chain fatty acids promote prostate cancer progression via inducing cancer cell autophagy and M2 macrophage polarization | ||
Clin Immunol Exploring TH17-mediated inflammation in epidermolytic ichthyosis: Clinical and mechanistic insight | ||
Metabolism The chemokine CCL20 promotes hepatocyte cholesterol deposition during metabolic dysfunction-associated steatohepatitis by regulating OLR1 expression |







