CoraLite®594-conjugated CCR6 Monoclonal antibody

CCR6 Monoclonal Antibody for IF-P
Cat No. CL594-66801
Clone No.1C11A9

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF-P

BN 1, C C chemokine receptor type 6, C C CKR 6, CC CKR 6, CCR 6, CCR6, CD196, Chemokine receptor like 3, CKR L3, CKR6, CKRL3, CMKBR6, DCR2, DRY 6, DRY6, G protein coupled receptor 29, GPR CY4, GPR29, GPRCY4, LARC receptor, STRL22

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66801 targets CCR6 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24195

Product name: Recombinant human CCR6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-47 aa of BC037960

Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL

Predict reactive species
Full Name chemokine (C-C motif) receptor 6
Calculated Molecular Weight 42 kDa
GenBank Accession NumberBC037960
Gene Symbol CCR6
Gene ID (NCBI) 1235
RRIDAB_2920041
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51684
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCR6, also known CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed on most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector/memory T-cells and B-cells and plays a role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841).

Protocols

Product Specific Protocols
IF protocol for CL594 CCR6 antibody CL594-66801Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...