CCR6 Monoclonal antibody, PBS Only

• 

  IHC staining of human tonsillitis using 66801-1-Ig (same clone as 66801-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66801-1-Ig (CCR6 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66801-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66801-1-Ig (same clone as 66801-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66801-1-Ig (CCR6 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66801-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66801-1-Ig (same clone as 66801-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CCR6 antibody (66801-1-Ig, Clone: 1C11A9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66801-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 66801-1-Ig (same clone as 66801-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CCR6 antibody (66801-1-Ig, Clone: 1C11A9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66801-1-PBS in a different storage buffer formulation.

CCR6 Monoclonal Antibody for IHC, IF/ICC, IF-P, ELISA

Cat No. 66801-1-PBS

Clone No.1C11A9

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, IF/ICC, IF-P, ELISA

Synonyms

1C11A9, BN 1, C C chemokine receptor type 6, C C CKR 6, C-C chemokine receptor type 6

---

Product Information

66801-1-PBS targets CCR6 in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24195

  Product name: Recombinant human CCR6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-47 aa of BC037960

  Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL

• Full Name: chemokine (C-C motif) receptor 6
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: BC037960
• Gene Symbol: CCR6
• Gene ID (NCBI): 1235
• RRID: AB_2882144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51684
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCR6, also known as CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed in most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector/memory T-cells, and B-cells and plays a role in skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841).