Tested Applications
| Positive WB detected in | MCF-7 cells, C6 cells, K-562 cells, T-47D cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25898-1-AP targets CCR7 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22941 Product name: Recombinant human CCR7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 279-378 aa of BC035343 Sequence: YNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 7 |
| Calculated Molecular Weight | 378 aa, 43 kDa |
| Observed Molecular Weight | 40-43 kDa |
| GenBank Accession Number | BC035343 |
| Gene Symbol | CCR7 |
| Gene ID (NCBI) | 1236 |
| RRID | AB_2880289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P32248 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-C chemokine receptor type 7 (CCR7), which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probably acts as a mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CCR7 antibody 25898-1-AP | Download protocol |
| WB protocol for CCR7 antibody 25898-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CCR7 Polyclonal antibody (Cat# 25898-1-AP) has 33 citations published in journals including Nature Communications, Bioactive Materials, ACS Nano, Journal of Experimental & Clinical Cancer Research, Cancer Letters, Acta Biomaterialia, and Stem Cell Research & Therapy. Research fields span immunology, oncology, tissue engineering and biomaterials, wound healing, inflammation, allergy, spinal cord injury repair, asthma, keloid formation, and kidney disease.
| Species | Application | Title |
|---|---|---|
Bioact Mater Two-stage degradation and novel functional endothelium characteristics of a 3-D printed bioresorbable scaffold. | ||
Bioact Mater Astaxanthin-metformin conjugate nanomicelles-loaded hydrogel reprograms macrophage metabolism via mitochondrion-targeted regulation for diabetic wound healing. | ||
Nat Commun Single-cell sequencing shows cellular heterogeneity of cutaneous lesions in lupus erythematosus | ||
Nat Commun Mature and migratory dendritic cells promote immune infiltration and response to anti-PD-1 checkpoint blockade in metastatic melanoma. | ||
ACS Nano Virus-Mimetic Extracellular-Vesicle Vaccine Boosts Systemic and Mucosal Immunity via Immune Recruitment | ||
ACS Nano Antigen Self-Presented Personalized Nanovaccines Boost the Immunotherapy of Highly Invasive and Metastatic Tumors |
