CCR7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CCR7 Recombinant monoclonal antibody, PBS Only (86180-5-PBS)

CCR7 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86180-5-PBS

Clone No.251886C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

BLR2, C C chemokine receptor type 7, C C CKR 7, C-C chemokine receptor type 7, CC CKR 7

• 

  WB analysis using 86180-5-RR (same clone as 86180-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86180-5-RR (CCR7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86180-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86180-5-RR (same clone as 86180-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86180-5-RR (CCR7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86180-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of K-562 using 86180-5-RR (same clone as 86180-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using CCR7 antibody (86180-5-RR, Clone: 251886C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86180-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86180-5-RR

  Biolayer interferometry (BLl) kinetic assays of 86180-5-RR against Human CCR7 were performed. The affinity constant is 8.06 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86180-5-PBS targets CCR7 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2354

  Product name: recombinant human CCR7 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 25-59 aa of BC035343

  Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAW

• Full Name: chemokine (C-C motif) receptor 7
• Calculated Molecular Weight: 378 aa, 43 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC035343
• Gene Symbol: CCR7
• Gene ID (NCBI): 1236
• RRID: AB_3744690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P32248
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C-C chemokine receptor type 7 (CCR7) , which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probablely acts as mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.