Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21018-1-AP targets CCR9 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15268 Product name: Recombinant human CCR9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-369 aa of BC069678 Sequence: LSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 9 |
| Calculated Molecular Weight | 369 aa, 42 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC069678 |
| Gene Symbol | CCR9 |
| Gene ID (NCBI) | 10803 |
| RRID | AB_3742013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P51686 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCR9 is a Gi-coupled chemokine receptor that directs T cell migration to the small intestine through interaction with CCL25, playing an essential role in thymocyte development and mucosal immune surveillance. Dysregulation of CCR9 signaling contributes to intestinal inflammatory diseases and hematologic malignancies, highlighting its importance in tissue-specific lymphocyte homing and immune regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CCR9 antibody 21018-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

