CCR9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCR9 Polyclonal antibody (21018-1-AP)

• 

  WB analysis using 21018-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21018-1-AP (CCR9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CCR9 Polyclonal Antibody for WB, ELISA

Cat No. 21018-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C C chemokine receptor type 9, C C CKR 9, CC CKR 9, CCR 9, CDw199

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21018-1-AP targets CCR9 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15268

  Product name: Recombinant human CCR9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-369 aa of BC069678

  Sequence: LSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL

• Full Name: chemokine (C-C motif) receptor 9
• Calculated Molecular Weight: 369 aa, 42 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC069678
• Gene Symbol: CCR9
• Gene ID (NCBI): 10803
• RRID: AB_3742013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P51686
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCR9 is a Gi-coupled chemokine receptor that directs T cell migration to the small intestine through interaction with CCL25, playing an essential role in thymocyte development and mucosal immune surveillance. Dysregulation of CCR9 signaling contributes to intestinal inflammatory diseases and hematologic malignancies, highlighting its importance in tissue-specific lymphocyte homing and immune regulation.