Use Able AI chat for product recommendations

CCS Polyclonal antibody

CCS Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Superoxide Dismutase 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CCS in ?

Tested Applications

Positive WB detected inHepG2 cells
Positive IP detected inHepG2 cells
Positive IHC detected inmouse brain tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22802-1-AP targets CCS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18850

Product name: Recombinant human CCS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-274 aa of BC105016

Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

Predict reactive species
Full Name copper chaperone for superoxide dismutase
Calculated Molecular Weight 274 aa, 29 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC105016
Gene Symbol CCS
Gene ID (NCBI) 9973
RRIDAB_2879172
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14618
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Copper chaperone for superoxide dismutase (CCS) is a soluble factor that converts copper into copper-zinc superoxide dismutase ( SOD1 ). CCS and SOD1 interact directly in vivo and in vitro, and this interaction is mediated by homologous domains in each protein. CCS not only interacts with wild-type SOD1 but also interacts with SOD1 containing common missense mutations, resulting in FALS.

Protocols

Product Specific Protocols
IF protocol for CCS antibody 22802-1-APDownload protocol
IHC protocol for CCS antibody 22802-1-APDownload protocol
IP protocol for CCS antibody 22802-1-APDownload protocol
WB protocol for CCS antibody 22802-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The antibody CCS (Cat# 22802-1-AP) has 15 total citations published in journals including Cell Stem Cell, Nature Communications, ACS Nano, Cell Reports, Cancer Letters, British Journal of Cancer, FASEB Journal, and Molecular Biology of the Cell. Research fields span copper homeostasis, cuproptosis, cancer biology (breast, lung, colorectal), neurodegeneration (ALS, motor neuron disease), nanomedicine, and tissue repair. Applications include WB and IHC in human and mouse samples.

SpeciesApplicationTitle
humanWB

Cell Stem Cell

Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.

Authors - Rashim Pal Singh

Nat Commun

Nanoparticle-enabled tuning of cell density for enhanced adhesion and tissue repair.

Authors - Hyun Su Park

ACS Nano

A First-Aid Nanomedicine Endowed with Microenvironment Self-Adaptive Regulation Ability to Facilitate Acute Liver Failure Prophylaxis and Therapy.

Authors - Jiale Zhang
mouseWB

J Nanobiotechnology

Rationally designed catalytic nanoplatform for enhanced chemoimmunotherapy via deploying endogenous plus exogenous copper and remodeling tumor microenvironment

Authors - Daxi Sun

Adv Sci (Weinh)

Disruption of NF-κB-Mediated Copper Homeostasis Sensitizes Breast Cancer to Cuproptosis

Authors - Xiaomei Zhang
humanIHC

Cancer Lett

The E3 ligase TRIM22 functions as a tumor suppressor in breast cancer by targeting CCS for proteasomal degradation to inhibit STAT3 signaling

Authors - Yunkai Yang
Loading...
||
New chat

Able™

正在加载,请稍候...