CCS Monoclonal antibody, PBS Only

• 

  WB analysis using 68341-1-Ig (same clone as 68341-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68341-1-Ig (CCS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68341-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68341-1-Ig (same clone as 68341-1-PBS)

  WB result of CCS antibody (68341-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CCS transfected HepG2 cells. This data was developed using the same antibody clone with 68341-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68341-1-Ig (same clone as 68341-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68341-1-Ig (CCS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68341-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68341-1-Ig (same clone as 68341-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using CCS antibody (68341-1-Ig, Clone: 3F5E5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68341-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CCS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68341-1-PBS

Clone No.3F5E5

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CCS

---

Product Information

68341-1-PBS targets CCS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18860

  Product name: Recombinant human CCS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-274 aa of BC105016

  Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

• Full Name: copper chaperone for superoxide dismutase
• Calculated Molecular Weight: 274 aa, 29 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC105016
• Gene Symbol: CCS
• Gene ID (NCBI): 9973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14618
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Copper chaperone for superoxide dismutase (CCS) is a soluble factor that converts copper into copper-zinc superoxide dismutase ( SOD1 ). CCS and SOD1 interact directly in vivo and in vitro, and this interaction is mediated by homologous domains in each protein. CCS not only interacts with wild-type SOD1 but also interacts with SOD1 containing common missense mutations, resulting in FALS.