CCSAP Polyclonal antibody

• 

  WB analysis using 28644-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28644-1-AP (C1orf96 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 28644-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28644-1-AP (CCSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 28644-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28644-1-AP (CCSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CCSAP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28644-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C1orf96, Centriole, cilia and spindle-associated protein, CSAP

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28644-1-AP targets CCSAP in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23785

  Product name: Recombinant human C1orf96 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-270 aa of BC015419

  Sequence: MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA

• Full Name: chromosome 1 open reading frame 96
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC015419
• Gene Symbol: CCSAP/C1orf96
• Gene ID (NCBI): 126731
• RRID: AB_3086074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCSAP (Centriole, cilia and spindle-associated protein) colocalizes with polyglutamylated tubulin to centrioles, spindle microtubules, and cilia in human tissue culture cells (PMID: 22493317). Plays a role in microtubule (MT) stabilization and this stabilization involves the maintenance of NUMA1 at the spindle poles. It can be detected as around 30-36 kDa.