Filter: AllWBIHCIF/ICCFC (Intra)

WB analysis using 67961-1-Ig (same clone as 67961-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67961-1-Ig (CCT6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 67961-1-Ig (same clone as 67961-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67961-1-Ig (CCT6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 67961-1-Ig (same clone as 67961-1-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67961-1-Ig (CCT6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 67961-1-Ig (same clone as 67961-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 67961-1-Ig (CCT6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 67961-1-Ig (same clone as 67961-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67961-1-Ig (CCT6B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 67961-1-Ig (same clone as 67961-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67961-1-Ig (CCT6B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 67961-1-Ig (same clone as 67961-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CCT6B antibody (67961-1-Ig, Clone: 2F11A9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
FC experiment of U2OS using 67961-1-Ig (same clone as 67961-1-PBS)
1X10^6 U2OS cells were intracellularly stained with 0.4 ug Anti-Human CCT6B (67961-1-Ig, Clone:2F11A9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.
×
1X10^6 U2OS cells were intracellularly stained with 0.4 ug Anti-Human CCT6B (67961-1-Ig, Clone:2F11A9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67961-1-PBS in a different storage buffer formulation.

CCT6B Monoclonal antibody, PBS Only

CCT6B Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67961-1-PBS

Clone No.2F11A9

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CCT zeta 2, CCTZ 2, Cctz2, CCT-zeta-2, CCT-zeta-like

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67961-1-PBS targets CCT6B in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag31295 Product name: Recombinant human CCT6B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 231-530 aa of BC027591 Sequence: LICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK Predict reactive species
Full Name	chaperonin containing TCP1, subunit 6B (zeta 2)
Calculated Molecular Weight	530 aa, 58 kDa
Observed Molecular Weight	53-58 kDa
GenBank Accession Number	BC027591
Gene Symbol	CCT6B
Gene ID (NCBI)	10693
RRID	AB_2918712
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q92526
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CCT6B, also named as CCT-zeta-2, TCP-1-zeta-like, CCT-zeta-like, Testis-specific Tcp20 and Testis-specific protein TSA303, belongs to the TCP-1 chaperonin family. CCT6B is a molecular chaperone which assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin. CCT6B has 3 isoforms with the molecular mass of 53-58 kDa.