Tested Applications
| Positive WB detected in | Neuro-2a cells, HeLa cells |
| Positive IHC detected in | human tonsillitis tissue, human colon tissue, human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27516-1-AP targets CD100 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species |
| Full Name | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Calculated Molecular Weight | 96 kDa |
| Observed Molecular Weight | 96 kDa |
| GenBank Accession Number | BC054500 |
| Gene Symbol | SEMA4D/CD100 |
| Gene ID (NCBI) | 10507 |
| RRID | AB_2880896 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92854 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD100 (also known as SEMA4D), a 150 kDa homodimer, belongs to the family of immune semaphorins, and CD100 is abundantly expressed on resting T cells, NK cells, and antigen-presenting cells. As a transmembrane glycoprotein, it is digested to its soluble form, sCD100, by specific matrix metalloproteinases. CD100 has been reported that the expression levels of CD100, and one of its receptors, plexin-B1 (PLXNB1), are increased in head and neck, prostate, colon, breast, and lung cancers, and the interaction between them provides oncogenic signaling essential for tumor growth and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD100 antibody 27516-1-AP | Download protocol |
| WB protocol for CD100 antibody 27516-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD100 Polyclonal antibody (Cat# 27516-1-AP) has 1 citation to date. It appears in Journal of Hazardous Materials (IF 10.6), published in 2025. The cited study investigated diesel exhaust–promoted diethylnitrosamine-induced hepatocarcinogenesis in mice, placing the research field in environmental toxicology and liver cancer. The antibody was used for Western blot (WB) with mouse samples.
| Species | Application | Title |
|---|---|---|
J Hazard Mater Diesel exhaust promoted diethylnitrosamine-induced hepatocarcinogenesis in mice |















