Anti-Mouse CD107a / LAMP1 Rabbit Recombinant Antibody, PBS Only

• 

  IF Staining of mouse liver using 98537-2-RR (same clone as 98537-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using LAMP-1/CD107a antibody (98537-2-RR, Clone: 250972H5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98537-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 98537-2-RR (same clone as 98537-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using LAMP-1/CD107a antibody (98537-2-RR, Clone: 250972H5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98537-2-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 98537-2-RR (same clone as 98537-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using LAMP-1/CD107a antibody (98537-2-RR, Clone: 250972H5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 98537-2-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse peritoneal macrophages using 98537-2-RR (same clone as 98537-2-PBS)

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse LAMP-1/CD107a Rabbit RecAb (98537-2-RR, Clone: 250972H5) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98537-2-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse peritoneal macrophages using 98537-2-RR (same clone as 98537-2-PBS)

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse LAMP-1/CD107a Rabbit RecAb (98537-2-RR, Clone: 250972H5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98537-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98537-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98537-2-RR against Mouse CD107a / LAMP1 were performed. The affinity constant is below 1 pM.

CD107a / LAMP1 Uni-rAb^® Recombinant Antibody for IF/ICC, IF-P, FC

Cat No. 98537-2-PBS

Clone No.250972H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC, IF-P, FC

Synonyms

CD107a, Lamp1, Lamp 1

---

Product Information

98537-2-PBS targets CD107a / LAMP1 in IF/ICC, IF-P, FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3858

  Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 25-370 aa of NM_010684.3

  Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

• Full Name: lysosomal-associated membrane protein 1
• Calculated Molecular Weight: 44 kDa
• GenBank Accession Number: NM_010684.3
• Gene Symbol: CD107a
• Gene ID (NCBI): 16783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11438
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697).