Mouse CD107b / LAMP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84474-5-RR (same clone as 84474-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84474-5-RR (CD107b / LAMP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84474-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84474-5-RR (same clone as 84474-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84474-5-RR (CD107b / LAMP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84474-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84474-5-RR (same clone as 84474-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84474-5-RR (CD107b / LAMP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84474-5-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 84474-5-RR (same clone as 84474-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using CD107b / LAMP2 antibody (84474-5-RR, Clone: 241893A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84474-5-PBS in a different storage buffer formulation.

CD107b / LAMP2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84474-5-PBS

Clone No.241893A7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CD107b, Lamp2, 241893A7, Lamp 2, Mac3

---

Product Information

84474-5-PBS targets CD107b / LAMP2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2029

  Product name: Recombinant Mouse CD107b/LAMP2 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-379 aa of NM_001017959.2

  Sequence: LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN

• Full Name: lysosomal-associated membrane protein 2
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 90-110 kDa
• GenBank Accession Number: NM_001017959.2
• Gene Symbol: CD107b / LAMP2
• Gene ID (NCBI): 16784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17047-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LAMP2 (CD107b) is a Lysosomal membrane glycoprotein. LAMP2 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP-2 is localized primarily in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane under certain circumstances, e.g., after platelet activation, during granulocytic differentiation and activation, and in some tumor cells (PMID: 12221139). LAMP is involved in lysosomal stability and autophagy (PMID: 12221139). This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may plays a role in tumor cell metastasis (PMID 9426697).