Anti-Mouse CD117/c-Kit Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98041-1-RR (same clone as 98041-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD117/c-Kit Rabbit RecAb (98041-1-RR, Clone: 240246C11) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD45R (B220) (RA3-6B2) (CL647-65139, Clone: RA3-6B2). Cells were not fixed. This data was developed using the same antibody clone with 98041-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98041-1-RR (same clone as 98041-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD117/c-Kit Rabbit RecAb (98041-1-RR, Clone: 240246C11) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98041-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98041-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98041-1-RR against Mouse CD117/c-Kit were performed. The affinity constant is 0.281 nM.

CD117/c-Kit Uni-rAb^® Recombinant Antibody for FC

Cat No. 98041-1-PBS

Clone No.240246C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD117, Kit, 240246C11, c KIT

---

Product Information

98041-1-PBS targets CD117/c-Kit in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0883

  Product name: Recombinant Mouse CD117/c-kit protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-527 aa of NM_001122733.1

  Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP

• Full Name: kit oncogene
• Calculated Molecular Weight: 109 kDa
• GenBank Accession Number: NM_001122733.1
• Gene Symbol: CD117
• Gene ID (NCBI): 16590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P05532-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD117, also known as c-Kit and SCFR, is a transmembrane protein with tyrosine kinase activity encoded by the oncogene c-kit (PMID: 2448137). It is a member of the type III receptor tyrosine kinase family, which also includes CSF-1R, PDGFRβ, PDGFRα, and FLT3 (PMID: 29518044). CD117 is expressed on hematopoietic stem cells and progenitor cells, mast cells, and is also found in a wide range of non-haemopoietic cell types (including melanocytes, germ cells, astrocytes, renal tubules, breast glandular epithelial cells, sweat glands, and interstitial cells of Cajal) (PMID: 10582338; 23073628). CD117 plays an important role in early haemopoiesis. It is also involved in pigmentation, fertility, gut movement, and some aspects of the nervous system (PMID: 23073628).