Mouse CD117/c-Kit Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Cytometric bead array standard curve of MP00418-1

  Cytometric bead array standard curve of MP00418-1, MOUSE CD117/c-kit Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83419-1-PBS. Detection antibody: 83419-2-PBS. Standard: Eg0883. Range: 0.781-25 ng/mL.

• 

  Cytometric bead array standard curve of MP00418-3

  Cytometric bead array standard curve of MP00418-3, MOUSE CD117/c-kit Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83419-3-PBS. Detection antibody: 83419-2-PBS. Standard: Eg0883. Range: 6.25-100 ng/mL.

CD117/c-Kit Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83419-2-PBS

Clone No.240246G11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD117, Kit, c KIT

---

Product Information

83419-2-PBS targets CD117/c-Kit as part of a matched antibody pair:

MP00418-1: 83419-1-PBS capture and 83419-2-PBS detection (validated in Cytometric bead array)

MP00418-3: 83419-3-PBS capture and 83419-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0883

  Product name: Recombinant Mouse CD117/c-kit protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-527 aa of NM_001122733.1

  Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP

• Full Name: kit oncogene
• Calculated Molecular Weight: 109 kDa
• GenBank Accession Number: NM_001122733.1
• Gene Symbol: CD117
• Gene ID (NCBI): 16590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05532-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.