CD11b Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD11b Polyclonal antibody (31745-1-AP)

CD11b Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 31745-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

CR3, CR3A, integrin alpha M, Itgam, Ly 40

• 

  WB analysis using 31745-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31745-1-AP (CD11b antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 31745-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31745-1-AP (CD11b antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 31745-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 31745-1-AP (CD11b antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 31745-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31745-1-AP (CD11b antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 31745-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31745-1-AP (CD11b antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 31745-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using CD11b antibody (31745-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of RAW 264.7 using 31745-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using CD11b antibody (31745-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of BV-2 using 31745-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed BV-2 cells using CD11b antibody (31745-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD11b in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: J774A.1 cells, RAW 264.7 cells
• Positive IHC detected in: mouse lung tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue
• Positive IF/ICC detected in: RAW 264.7 cells, BV-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31745-1-AP targets CD11b in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36145

  Product name: Recombinant mouse Itgam protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 925-1105 aa of BC156991

  Sequence: AIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFNNLGQRSLPVSVVFWIPVQINNVTVWDHPQVIFSQNLSSACHTEQKSPPHSNFRDQLERTPVLNCSVAVCKRIQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHGHLLLVSSTEILFNDSAFALLPGQESYVRSKTETKVEPYEVHN

• Full Name: integrin alpha M
• Calculated Molecular Weight: 127 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC156991
• Gene Symbol: CD11b
• Gene ID (NCBI): 16409
• RRID: AB_3670104
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: E9Q604
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). CD11b, also known as Integrin alpha M or CR3A, belongs to the integrin alpha chain family. CD11b forms an α/β heterodimer with CD18 (integrin β2). CD11b/CD18 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PMID: 9558116; 20008295). CD11b/CD18 is a receptor for the complement protein fragment iC3b, and is also a receptor for fibrinogen, factor X and ICAM1 (PMID: 2971974; 15485828).

Publications

What published studies show

CD11b Polyclonal antibody (Cat# 31745-1-AP) has 10 total citations. These appear in journals including Advanced Science, Phytomedicine, ACS Applied Materials & Interfaces, Biomaterials Advances, European Journal of Pharmacology, Immunology, Arthritis Research & Therapy, Stem Cells Development, Scientific Reports, and FASEB Journal. Research fields span neurocognitive impairment, metabolic liver disease, hepatocellular carcinoma, ulcerative colitis, tumor immunology, psoriasis, arthritis, stroke, cardiac injury, and wound fibrosis—primarily involving macrophage biology in mouse models.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); Inhibiting Liver-Derived C3 Protein Rescues Anesthesia/Surgery-Induced Cognitive Impairment, Synaptic Disorders, and Microglial Phagocytosis.; Authors - Qianqian Wu
mouse	IF	Phytomedicine; Xiayuxue decoction alleviates MASH by regulating gut microbiota, bile acid metabolism, and m(6)A modification.; Authors - Jiewen Shi
mouse	WB	ACS Appl Mater Interfaces; Genetically Engineered Membrane-Mimetic Liposome-Wrapped Violet Phosphorus Nanoplatform for Targeted Synergistic Ferroptosis/Photothermal/Immunotherapy of Hepatocellular Carcinoma.; Authors - Shuo Li
mouse	WB	Biomater Adv; Macrophage-mimetic, glycyrrhizic acid-functionalized liposomes for targeted delivery of celastrol in ulcerative colitis.; Authors - Wenjing Yang
mouse	IF	Eur J Pharmacol; Clofibrate inhibits tumor immune escape by increasing macrophage phagocytosis.; Authors - Huijie Wang
mouse	IF	Arthritis Res Ther; Cyclovirobuxine D attenuates collagen-induced arthritis by inhibiting PI3K/AKT pathway and macrophage polarization.; Authors - Yaozong Sun