CD133 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD133 Recombinant monoclonal antibody (87640-1-RR)

• 

  WB analysis using 87640-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87640-1-RR (CD133 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87640-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87640-1-RR against Human CD133 were performed. The affinity constant is 1.47 nM.

CD133 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87640-1-RR

Clone No.253087D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AC133, Antigen AC133, CORD12, MCDR2, MSTP061

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87640-1-RR targets CD133 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3738

  Product name: Recombinant human CD133 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 179-433 aa of NM_006017

  Sequence: ANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEEYDSY

• Full Name: prominin 1
• Calculated Molecular Weight: 97kd
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_006017
• Gene Symbol: CD133
• Gene ID (NCBI): 8842
• RRID: AB_3745669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43490
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).