Anti-Human CD147 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human CD147 Rabbit Recombinant Antibody (98558-1-RR)

• 

  FC experiment of human PBMCs using 98558-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD147 Rabbit RecAb (98558-1-RR, Clone: 251215H5) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using 98558-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD147 Rabbit RecAb (98558-1-RR, Clone:251215H5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98558-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98558-1-RR against Human CD147 were performed. The affinity constant is 1.08 nM.

CD147 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98558-1-RR

Clone No.251215H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

5F7, Basigin, BSG, Collagenase stimulatory factor, EMMPRIN

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98558-1-RR targets CD147 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0436

  Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 138-323 aa of BC009040

  Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

• Full Name: basigin (Ok blood group)
• Calculated Molecular Weight: 385 aa, 42 kDa
• GenBank Accession Number: BC009040
• Gene Symbol: CD147
• Gene ID (NCBI): 682
• RRID: AB_3746178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35613
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211).