Anti-Human CD151 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human CD151 Rabbit Recombinant Antibody (98881-1-RR)

CD151 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98881-1-RR

Clone No.252763F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD151 antigen, GP27, Membrane glycoprotein SFA 1, Membrane glycoprotein SFA-1, MER2

• 

  FC experiment of human platelets using 98881-1-RR

  1x10^6 human platelets were surface stained with 0.25 ug Anti-Human CD151 Rabbit RecAb (98881-1-RR, Clone: 252763F9) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human platelets

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98881-1-RR targets CD151 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3476

  Product name: Recombinant Human CD151 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 113-221 aa of NM_004357.5

  Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

• Full Name: CD151 molecule (Raph blood group)
• Calculated Molecular Weight: 28kDa
• GenBank Accession Number: NM_004357.5
• Gene Symbol: CD151
• Gene ID (NCBI): 977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48509
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells.