Mouse CD155/PVR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Mouse CD155/PVR Polyclonal antibody, PBS Only (31447-1-PBS)

• 

  WB analysis using 31447-1-AP (same clone as 31447-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31447-1-AP (CD155/PVR antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31447-1-AP (same clone as 31447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31447-1-AP (CD155/PVR antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31447-1-AP (same clone as 31447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31447-1-AP (CD155/PVR antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 31447-1-AP (same clone as 31447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31447-1-AP (CD155/PVR antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 31447-1-AP (same clone as 31447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31447-1-AP (CD155/PVR antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 31447-1-AP (same clone as 31447-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using CD155/PVR antibody (31447-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31447-1-PBS in a different storage buffer formulation.

CD155/PVR Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31447-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Pvr, CD155, poliovirus receptor, Tage4

---

Product Information

31447-1-PBS targets CD155/PVR in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0903

  Product name: Recombinant Mouse CD155/PVR protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 29-348 aa of NM_027514.2

  Sequence: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL

• Full Name: poliovirus receptor
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: NM_027514.2
• Gene Symbol: CD155/PVR
• Gene ID (NCBI): 52118
• RRID: AB_3669988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8K094
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD155, also known as the poliovirus receptor (PVR) or Necl-5, is one of the nectin-like family members, belonging to the Ca2+ independent immunoglobulin superfamily (IgSF) in cell adhesion molecules (PMID: 37660884). CD155 is a type I transmembrane protein composed of three extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tail. It is involved in cell-to-cell and cell-to-ECM adhesion (PMID: 32019260; 11437656). CD155 acts as a ligand for immune receptors, including TIGIT, CD96 and CD226, which are expressed on T cells and NK cells. CD155 interacts with these receptors to modulate immune responses, such as T cell activation and NK cell-mediated cytotoxicity (PMID: 37660884). CD155 serves as the entry receptor for poliovirus and thereby mediates susceptibility to poliovirus infection (PMID: 15034010).