CD158K/KIR3DL2 Polyclonal antibody

CD158K/KIR3DL2 Polyclonal Antibody for WB, ELISA
Cat No. 33010-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

KIR3DL2, CD158K, MHC class I NK cell receptor, NKAT 4, NKAT4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNK-92 cells, mouse spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

33010-1-AP targets CD158K/KIR3DL2 in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg4355

Product name: recombinant human CD158K/KIR3DL2 protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 22-340 aa of NM_006737.4

Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH

Predict reactive species
Full Name killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
Calculated Molecular Weight50 kDa
Observed Molecular Weight 50-60 kda
GenBank Accession NumberNM_006737.4
Gene Symbol KIR3DL2
Gene ID (NCBI) 3812
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP43630-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIR3DL2, also known as CD158k, is an inhibitory receptor expressed by natural killer (NK) cells and a subset of CD8+ T cells. It plays a role in immune regulation by binding to HLA class I molecules, specifically HLA-A3 and HLA-A11, in a peptide-dependent fashion. KIR3DL2 can also function as an innate immune receptor for delivering CpG DNA to TLR9 in NK cells, highlighting its role in both adaptive and innate immunity. This protein is primarily expressed on the cell surface, particularly in NK cells and certain T cells. It has been implicated in various diseases, particularly in the context of hematological malignancies and autoimmune diseases. Aberrant expression of KIR3DL2 has been observed in neoplastic cells in transformed mycosis fungoides and Sézary syndrome, suggesting its potential as a therapeutic target in primary cutaneous anaplastic large-cell lymphoma (pcALCL).

Protocols

Product Specific Protocols
WB protocol for CD158K/KIR3DL2 antibody 33010-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...