Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® CoraLite® Plus 647 Anti-Mouse CD16/CD32 Rabbit Recombinant Antibody

CD16/CD32 FcZero-rAb® Recombinant Antibody for FC

Cat No. CL647-FcA98679
Clone No.252820A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Fc receptor, IgG, low affinity III, Fcgr3

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98679 targets CD16/CD32 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3474

Product name: Recombinant Mouse CD16 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 31-215 aa of NM_001356511

Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Predict reactive species
Full Name Fc receptor, IgG, low affinity III
Calculated Molecular Weight30 kDa
GenBank Accession NumberNM_001356511
Gene Symbol Fcgr3
Gene ID (NCBI) 14131
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Rabbit anti mouse CD16/32 antibody, clone 252820A1 is specific to the common epitope of CD16 and CD32. It can be used for blocking non-specific binding of immunoglobulins to the Fc receptors by preincubating the cells with the purified antibody at 1 ug per million cells in 100 uL volume for 5-10 minutes prior to immunostaining.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CD16/CD32 antibody CL647-FcA98679Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...