CD16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD16 Polyclonal antibody (30567-1-AP)

CD16 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 30567-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD16A, CD16a antigen, CD16-II, Fc gamma RIII, Fc gamma RIII alpha

• 

  WB analysis using 30567-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30567-1-AP (CD16 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 30567-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 30567-1-AP (CD16 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 30567-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 30567-1-AP (CD16 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 30567-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD16 antibody (30567-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 30567-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD16 antibody (30567-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human peripheral blood leukocyte
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30567-1-AP targets CD16 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg31662

  Product name: Recombinant Human FCGR3A/CD16a (F176V) protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 17-208 aa of BC017865

  Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

• Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
• Calculated Molecular Weight: 254 aa, 29 kDa
• Observed Molecular Weight: 50-70 kDa
• GenBank Accession Number: BC017865
• Gene Symbol: CD16a
• Gene ID (NCBI): 2214
• ENSEMBL Gene ID: ENSG00000203747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08637
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD16 is a low affinity Fc receptor. It has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B. In humans, FcγRIIIa/CD16a is a type I transmembrane receptor expressed on macrophages and NK cells. FcγRIIIb/CD16b is a GPI-linked Fc-receptor highly expressed on neutrophils. The two proteins differ by only four amino acid residues in the mature proteins(PMID: 30361439). FCGR3A has a calculated molecular weight of 29 kDa, with an apparent molecular weight of 50-80 kDa due to extensive glycosylation (PMID: 30655272; PMID: 27914599).