Tested Applications
| Positive WB detected in | human placenta tissue, pig spleen tissue |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue, human liver tissue, human lung tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human liver tissue, human placenta tissue, human lung cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16646-1-AP targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10029 Product name: Recombinant human CD163 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 46-401 aa of BC051281 Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG Predict reactive species |
| Full Name | CD163 molecule |
| Calculated Molecular Weight | 1156 aa, 125 kDa |
| Observed Molecular Weight | 130-150 kDa |
| GenBank Accession Number | BC051281 |
| Gene Symbol | CD163 |
| Gene ID (NCBI) | 9332 |
| ENSEMBL Gene ID | ENSG00000177575 |
| RRID | AB_2756528 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86VB7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD163 antibody 16646-1-AP | Download protocol |
| IHC protocol for CD163 antibody 16646-1-AP | Download protocol |
| IP protocol for CD163 antibody 16646-1-AP | Download protocol |
| WB protocol for CD163 antibody 16646-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD163 antibody (Cat# 16646-1-AP) has 339 total citations. Citations appear in journals including Cancer Cell, Nature Medicine, Cell, Nature Genetics, Nature Communications, Gastroenterology, Journal of Clinical Investigation, Advanced Science, Oncogene, Phytomedicine, and Frontiers in Immunology. Research fields span cancer immunology (tumor-associated macrophage polarization), neuroinflammation, wound healing, fibrosis, osteoarthritis, liver disease, cardiovascular disease, and immunotherapy.
| Species | Application | Title |
|---|---|---|
Cancer Cell Tissue tension fosters macrophage-driven lipid peroxidation-induced DNA damage. | ||
Nat Med Concurrent intrathecal and intravenous nivolumab in leptomeningeal disease: phase 1 trial interim results | ||
Cell Extracellular vesicles from the lung pro-thrombotic niche drive cancer-associated thrombosis and metastasis via integrin beta 2 | ||
Gastroenterology Macrophage-derived cathepsin S remodels the extracellular matrix to promote liver fibrogenesis | ||
Gastroenterology Targeting Stem Cells and Dysplastic Features With Dual MEK/ERK and STAT3 Suppression in Gastric Carcinogenesis | ||
Adv Mater Endogenous Metal Ion-Enriched Immunostimulating Biomimetic Scaffold Improves In Situ Bone Regeneration. |
Reviews
What customers say
Users report consistently positive results with this antibody, primarily in immunofluorescence and immunohistochemistry. It performed well on frozen mouse liver sections (1:500), FFPE prostate tissue (1:100 with Tris-EDTA retrieval), human cartilage, gastric cancer, and tumor samples. One reviewer noted clean staining of M2 macrophage cells. Dilutions ranged from 1:100 to 1:1000 depending on application and tissue type. Overall, reviewers describe it as working well or very well across diverse tissues and formats, with an average rating of approximately 4.4 out of 5.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Brittney (Verified Customer) (10-09-2025) | Antibody nicely stained M2 macrophage cells.
|
Jaouhara (Verified Customer) (12-05-2023) | Works very well in immunohistochemistry (human cartilage)
|
Kenzo (Verified Customer) (08-29-2023) | Works well by IF on frozen mouse liver tissue sections.
|
Yasuyo (Verified Customer) (05-27-2022) | Works pretty good.
 |
Emma (Verified Customer) (11-29-2021) | Works well by IF on FFPE tissue @ 1:100 with a Tris-EDTA antigen retrieval.
 |
