CD179b Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD179b Recombinant monoclonal antibody (87298-1-RR)

• 

  WB analysis using 87298-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87298-1-RR (IGLL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87298-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87298-1-RR against Human CD179b were performed. The affinity constant is 6.55 nM.

CD179b Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87298-1-RR

Clone No.252001F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IGLL1, CD179 antigen-like family member B, Ig lambda 5, Ig lambda-5, IGL1

---

Tested Applications

• Positive WB detected in: HL-60 cells, NALM-6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87298-1-RR targets CD179b in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3515

  Product name: recombinant human IGLL1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 38-213 aa of BC012293

  Sequence: LLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS

• Full Name: immunoglobulin lambda-like polypeptide 1
• Calculated Molecular Weight: 213 aa, 23 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC012293
• Gene Symbol: IGLL1
• Gene ID (NCBI): 3543
• RRID: AB_3745454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD179b, also known as IGLL1, VpreB (surrogate light chain, VpreB1), is a crucial protein component of the pre-B cell receptor (pre-BCR), which is essential for the early development of B lymphocytes (B cells) in the bone marrow.