Mouse CD19 Recombinant monoclonal antibody, PBS Only

CD19 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 83254-1-PBS
Clone No.240135A3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

240135A3, B-lymphocyte antigen CD19, CD19 antigen

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83254-1-PBS targets CD19 in WB, IHC, IF-P, Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0907

Product name: Recombinant Mouse CD19 protein (His Tag)

Source: mammalian cells-derived, pCMV (S18)

Tag: C-6*HIS

Domain: 19-287 aa of NM_009844.2

Sequence: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Predict reactive species
Full Name CD19 antigen
Calculated Molecular Weight60 kDa
Observed Molecular Weight62-70 kDa
GenBank Accession NumberNM_009844.2
Gene Symbol Cd19
Gene ID (NCBI) 12478
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25918
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD19 is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908).

Loading...
||
New chat Able
正在加载,请稍候...