CD1c Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD1c Recombinant monoclonal antibody (87145-2-RR)

CD1c Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 87145-2-RR Copied!

Clone No. 252399G7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BDCA1, CD1, CD1c molecule, R7, T-cell surface glycoprotein CD1c

• 

  WB analysis using 87145-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87145-2-RR (CD1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 87145-2-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87145-2-RR (CD1c antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 87145-2-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CD1C antibody (87145-2-RR, Clone: 252399G7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87145-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87145-2-RR against Human CD1c were performed. The affinity constant is 15.7 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD1c in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, MOLT-4 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87145-2-RR targets CD1c in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg9187

  Product name: Recombinant human B2M-CD1C protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-Twin-Strep-Tag

  Domain: 18-333 aa of

  Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

• Full Name: CD1c molecule
• Observed Molecular Weight: 38 kDa
• Gene Symbol: CD1C
• Gene ID (NCBI): 911
• RRID: AB_3745368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29017
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD1c molecule (CD1c, also known as R7, CD1, CD1A, and BDCA1) is a member of the CD1 family of transmembrane glycoproteins, which is synthesized in the endoplasmic reticulum and expressed on the monocytes, marginal zone B cells in lymph nodes as well as peripheral blood (PMID: 23468110). The CD1 proteins belong to the family of major histocompatibility complex (MHC) class I-like proteins that present lipid-based antigens to T cells (PMID: 15032598; 23127489). CD1c shows interaction with both αβ or γδ T cells and mediates T cell responses against mycobacterium tuberculosis (PMID: 10727456; 10786796).