CD200 Recombinant monoclonal antibody, PBS Only

• 

CD200 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83051-1-PBS

Clone No.230268A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD200 molecule, MOX1, MOX2, MRC, OX 2

---

Product Information

83051-1-PBS targets CD200 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=2.44 x 10^-9M
  K_Off=4.33 x 10^-4M
  K_On=1.77 x 10^5M
• Immunogen:

  CatNo: Eg0006

  Product name: Recombinant Human CD200 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 31-232 aa of BC022522

  Sequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

• Full Name: CD200 molecule
• Calculated Molecular Weight: 269 aa, 30 kDa
• GenBank Accession Number: BC022522
• Gene Symbol: CD200
• Gene ID (NCBI): 4345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41217
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.