Anti-Mouse CD200R1 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD200R1 Rabbit Recombinant Antibody, PBS Only (98155-1-PBS)

CD200R1 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98155-1-PBS Copied!

Clone No. 241453E7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241453E7, CD200 receptor 1, CD200R, Mox2r, OX2R

• 

  FC experiment of mouse bone marrow cells using 98155-1-RR (same clone as 98155-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD200R1 Rabbit Recombinant Antibody (98155-1-RR, Clone: 241453E7) or Isotype Control, and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98155-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse bone marrow cells using 98155-1-RR (same clone as 98155-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD200R1 Rabbit Recombinant Antibody (98155-1-RR, Clone: 241453E7) (red) or Isotype Control (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98155-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98155-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98155-1-RR against Mouse CD200R1 were performed. The affinity constant is 3.33 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD200R1 in ?

Chat with Able

---

Product Information

98155-1-PBS targets CD200R1 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0988

  Product name: Recombinant Mouse CD200R1 protein (His tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-238 aa of NM_021325.3

  Sequence: TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

• Full Name: CD200 receptor 1
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: NM_021325.3
• Gene Symbol: Cd200r1
• Gene ID (NCBI): 57781
• RRID: AB_3672298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ES57
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cell surface glycoprotein CD200 receptor 1 (CD200R1) is also called CD200R, CRTR2, MOX2R, and OX2R, and belongs to the CD200R family. CD200R1 is an inhibitory receptor for the CD200/OX2 cell surface glycoprotein. CD200R1 is highly glycosylated, containing ten potential N-glycosylation sites (PMID: 15187158). CD200R1 limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. As an immune inhibitory molecule, CD200R1 binds to CD200, ultimately leading to the inhibition of classical activation of macrophages and microglia (PMID: 24588829).