CD207 Polyclonal antibody

• 

  WB analysis of human skin using 11841-1-AP

  human skin tissue were subjected to SDS PAGE followed by western blot with 11841-1-AP (Langerin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skin using 11841-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 11841-1-AP (Langerin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 11841-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 11841-1-AP (Langerin antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 11841-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 11841-1-AP (Langerin antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD207 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11841-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Langerin, CD207 molecule, langerin, CLEC4K, C-type lectin domain family 4 member K

---

Tested Applications

• Positive WB detected in: human skin tissue, mouse skin tissue
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:3000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11841-1-AP targets CD207 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2479

  Product name: Recombinant human CD207 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-328 aa of BC022278

  Sequence: MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

• Full Name: CD207 molecule, langerin
• Calculated Molecular Weight: 328 aa, 37 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC022278
• Gene Symbol: CD207
• Gene ID (NCBI): 50489
• RRID: AB_2074314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJ71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD207 protein (also known as langerin protein) is encoded by the CD207 gene and is a type of C-type lectin receptor that is specifically expressed on the surface of LCs. It is one of the specific immunohistochemical markers of LCs (PMID: 37383183, PMID: 28109175). CD207 plays an important role in a series of non-classical antigen processing processes, such as forming Birbeck granules and processing and transporting them to local lymphoid tissue, and inducing LC maturation (PMID: 32326440).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Elife; Cryo-electron tomography of Birbeck granules reveals the molecular mechanism of langerin lattice formation.; Authors - Toshiyuki Oda