Tested Applications
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28206-1-AP targets CD21 in IHC, IF-P, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27971 Product name: Recombinant human CR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 660-718 aa of BC136394 Sequence: GCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE Predict reactive species |
| Full Name | complement component (3d/Epstein Barr virus) receptor 2 |
| Calculated Molecular Weight | 1092 aa, 119 kDa |
| GenBank Accession Number | BC136394 |
| Gene Symbol | CD21 |
| Gene ID (NCBI) | 1380 |
| ENSEMBL Gene ID | ENSG00000117322 |
| RRID | AB_2881087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20023 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD21, also known as complement receptor type 2 (CR2), complement C3d receptor, and Epstein-Barr virus receptor, is a transmembrane protein that contains a small cytoplasmic domain, a transmembrane region and an extracellular domain consisting of 15 tandem short consensus repeat sequences (PMID: 6230668; 2551147). It is expressed on B cells, follicular dendritic cells, thymocytes and a subset of peripheral T cells (PMID: 26119182). CD21 binds complement fragments C3d, C3dg and iC3b and acts as a receptor for the Epstein-Barr virus (PMID: 7753047). On B cells, together with CD19 and CD81, CD21 forms a complex that functions as a co-receptor to the BCR (PMID: 7542009). It is involved in B cells activation and functions.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD21 antibody 28206-1-AP | Download protocol |
| IHC protocol for CD21 antibody 28206-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD21 Polyclonal antibody (Cat# 28206-1-AP) has 1 citation to date. It appears in Cancer Immunology, Immunotherapy, where it was used for IHC to study the association of CCL21-positive cancer-associated fibroblasts with B-cell recruitment and tertiary lymphoid structure maturation in penile squamous cell carcinoma. The research falls within the fields of cancer immunology and the tumor microenvironment.
| Species | Application | Title |
|---|---|---|
Cancer Immunol Immunother Association of CCL21(+) CAFs with B-cell recruitment and TLS maturation in penile squamous cell carcinoma. |
