CD21 Monoclonal antibody, PBS Only

CD21 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66701-1-PBS
Clone No.1D9A3

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

C3DR, CD21, Complement C3d receptor, Complement receptor type 2, CR2, EBV receptor, Epstein Barr virus receptor, SLEB9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66701-1-PBS targets CD21 in WB, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18058

Product name: Recombinant human CR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 581-930 aa of BC136394

Sequence: QERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKGCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCEETCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCLRSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGVPTCIKKAFIGCPPPPKTPNGNHTGGNIARFS

Predict reactive species
Full Name complement component (3d/Epstein Barr virus) receptor 2
Calculated Molecular Weight 1092 aa, 119 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC136394
Gene Symbol CD21
Gene ID (NCBI) 1380
ENSEMBL Gene IDENSG00000117322
RRIDAB_2882054
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20023
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD21, also known as complement receptor type 2 (CR2), complement C3d receptor, and Epstein-Barr virus receptor, is a transmembrane protein that contains a small cytoplasmic domain, a transmembrane region and an extracellular domain consisting of 15 tandem short consensus repeat sequences (PMID: 6230668; 2551147). It is expressed on B cells, follicular dendritic cells, thymocytes and a subset of peripheral T cells (PMID: 26119182). CD21 binds complement fragments C3d, C3dg and iC3b and acts as a receptor for the Epstein-Barr virus (PMID: 7753047). On B cells, together with CD19 and CD81, CD21 forms a complex that functions as a co-receptor to the BCR (PMID: 7542009). It is involved in B cells activation and functions.

Loading...
||
New chat Able
正在加载,请稍候...