CD226 Monoclonal antibody

CD226 Monoclonal Antibody for WB, ELISA
Cat No. 67653-1-Ig
Clone No.7G7A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

CD226, CD226 antigen, CD226 molecule, DNAM 1, DNAM1, DNAX accessory molecule 1, PTA1, TLiSA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman peripheral blood platelets

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67653-1-Ig targets CD226 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12403

Product name: Recombinant human CD226 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-254 aa of BC074787

Sequence: MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVA

Predict reactive species
Full Name CD226 molecule
Calculated Molecular Weight 336 aa, 39 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC074787
Gene Symbol CD226
Gene ID (NCBI) 10666
ENSEMBL Gene IDENSG00000150637
RRIDAB_2882852
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15762
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383).

Protocols

Product Specific Protocols
WB protocol for CD226 antibody 67653-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...