Mouse CD226 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86025-1-RR (same clone as 86025-1-PBS)

  Mouse spleen lysate was subjected to SDS PAGE followed by western blot with 86025-1-RR (CD226 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86025-1-PBS in a different storage buffer formulation.

CD226 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86025-1-PBS

Clone No.250384D8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

CD226 antigen, Dnam-1 , Platelet and T-cell activation antigen 1, Pta1

---

Product Information

86025-1-PBS targets CD226 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1588

  Product name: Recombinant Mouse CD226 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-254 aa of NM_178687.2

  Sequence: EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP

• Full Name: CD226 antigen
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 60-75 kDa
• GenBank Accession Number: NM_178687.2
• Gene Symbol: Cd226
• Gene ID (NCBI): 225825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8K4F0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes, and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383).