CD228/MFI2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD228/MFI2 Polyclonal antibody (33666-1-AP)

• 

  WB analysis using 33666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33666-1-AP (CD228/MFI2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

CD228/MFI2 Polyclonal Antibody for WB, ELISA

Cat No. 33666-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

CD228, Melanotransferrin, Meltf, Membrane-bound transferrin-like protein p97, Mfi2

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33666-1-AP targets CD228/MFI2 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6302

  Product name: Recombinant mouse CD228/MFI2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-708 aa of NM_013900.2

  Sequence: VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ

• Full Name: antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: NM_013900.2
• Gene Symbol: Mfi2
• Gene ID (NCBI): 30060
• RRID: AB_3743043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9R0R1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD228, also known as Melanotransferrin (MTF), p97, MFI2, etc., is an iron-binding glycoprotein belonging to the transferrin family. In normal tissues, the expression of CD228 is low, mainly confined to skin epidermis, brain endothelium, renal tubules, sweat gland and salivary gland ducts. However, in many tumor tissues, such as melanoma, non-small cell lung cancer, colorectal cancer, pancreatic cancer and so on, the expression of CD228 increased significantly. Soluble CD228 can cross the blood-brain barrier by interacting with transferrin receptor. In the brain, CD228 is located in microglia related to amyloid plaque cells in Alzheimer's disease. The increased concentration of CD228 in serum can be regarded as a surrogate marker of Alzheimer's disease.